PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.052860.1
Common NameCsa_6G291920, LOC101212503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 803aa    MW: 88791.7 Da    PI: 7.107
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.052860.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.33e-23169270199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++p++ ae++       ++ +  s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + +
  Cucsa.052860.1 169 FCKTLTASDTSTHGGFSVPRRAAEDCfppldytQLRP--SQELIAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLISGDAVLFL--RGE 259
                     99****************************9887775..458************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+++++r+
  Cucsa.052860.1 260 NGELRLGIRRA 270
                     9999****996 PP

2Auxin_resp121.75.4e-40295376182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +++a+stks+F+v+YnPra +++F+++++k++k+++++vsvG+Rfkm+fe++ds+err+ G+vvg+sd+d++rWpnSkWr+L
  Cucsa.052860.1 295 VVKAISTKSTFDVFYNPRAYHAQFIISCQKYVKSINNPVSVGTRFKMRFEMDDSPERRFNGVVVGISDMDSFRWPNSKWRCL 376
                     6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.9E-39162279IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.79E-43163280IPR015300DNA-binding pseudobarrel domain
CDDcd100178.12E-23167269No hitNo description
SMARTSM010197.5E-24169271IPR003340B3 DNA binding domain
PfamPF023624.2E-21169270IPR003340B3 DNA binding domain
PROSITE profilePS5086312.915169271IPR003340B3 DNA binding domain
PfamPF065077.8E-34296376IPR010525Auxin response factor
PROSITE profilePS5174520.062674758IPR000270PB1 domain
SuperFamilySSF542772.26E-8676753No hitNo description
PfamPF023093.4E-5722759IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MEIDLNQTAS EVGKNAYCYG NCEEGLCNCC LSSSTSSCSS NSSSTPVSSS TYLELWHACA  60
GPLTSLPKKG NVVVYFPQGH LEQIASASPF SPMEMRTFDL QPHILCRVIN VHLLANKEND  120
EVYTQLTLRP LPELLGTGVA GKELEELALN GADGDGSGGS PTRSTPHMFC KTLTASDTST  180
HGGFSVPRRA AEDCFPPLDY TQLRPSQELI AKDLHGVEWR FRHIYRGQPR RHLLTTGWSI  240
FVSQKNLISG DAVLFLRGEN GELRLGIRRA VRPRNGLPDS IVGNQNSCAN DLARVVKAIS  300
TKSTFDVFYN PRAYHAQFII SCQKYVKSIN NPVSVGTRFK MRFEMDDSPE RRFNGVVVGI  360
SDMDSFRWPN SKWRCLTVRW DKDSDHQERV SPWEIDPSVS LPPLSVQSSP RLKKLRTSLQ  420
AAPPNNAFTG RGGFMDFEDS VRSSKVLQGQ ENVGIVSPFY GCDTVKRSLE FDVRSSAQQN  480
QVSGGVEKLN IADYVKVHAN SSFTGFMESD RFLKVLQGQE ICSLRPPTSK PEYSLGVWGK  540
FNLSDNSFNT FQSPNSNFYH MASNSAQKMY FPRSEMHSTG QAAMMLSNDS NFPRESALFN  600
PSAVGANVIR TKMERTSRSL DRESLHLASA PPTLGSNMRN SKDEHVNDNA TGCKLFGFSL  660
TTETATNVQS SGKRSCTKVH KQGSLVGRAI DLSRLNGYTD LISELERLFS MEGLLKDPDK  720
GWRVLYTDNE NDVMVVGDYP WHDFCDAVSK IHIYTQEEVE KMTNGVISDD TQSCLDQAPL  780
CMEASKSSSV GQPDSPPTAV RG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-120373972354Auxin response factor 1
4ldw_A1e-120373972354Auxin response factor 1
4ldw_B1e-120373972354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234090.0KU323409.1 UNVERIFIED: Trichosanthes dioica clone TdARF_7 auxin response factor 4-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011657217.10.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A0A0KFX80.0A0A0A0KFX8_CUCSA; Auxin response factor
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52363252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Saito Y, et al.
    Isolation of cucumber CsARF cDNAs and expression of the corresponding mRNAs during gravity-regulated morphogenesis of cucumber seedlings.
    J. Exp. Bot., 2004. 55(401): p. 1315-23
    [PMID:15133054]
  2. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  3. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]